PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c18_340V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 283aa    MW: 32435.6 Da    PI: 8.9411
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c18_340V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.97.4e-11165207147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgrW +  de+l ++v q+ + +W++Ia+++     +k+c++rw++ 
  Pp3c18_340V3.1.p 165 RGRWRPAKDEKLRELVSQYRPQNWSLIAEKLH----GKSCRLRWFNQ 207
                       89******************************....5*******996 PP

2Myb_DNA-binding36.89.3e-12214258147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r ++T++ +e+l+ a++  G++ W+ I r +  gRt++ +k++w+ +
  Pp3c18_340V3.1.p 214 RRPFTEDGEERLLAAHRFQGNK-WAMIVRLFS-GRTDNAVKNHWHVV 258
                       679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.322160208IPR017930Myb domain
SuperFamilySSF466897.11E-19164255IPR009057Homeodomain-like
SMARTSM007171.2E-4164210IPR001005SANT/Myb domain
PfamPF002498.6E-9165207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-18166215IPR009057Homeodomain-like
CDDcd001673.32E-6167206No hitNo description
PROSITE profilePS5129415.178209263IPR017930Myb domain
SMARTSM007172.2E-7213261IPR001005SANT/Myb domain
PfamPF002491.0E-7214257IPR001005SANT/Myb domain
CDDcd001673.35E-5216259No hitNo description
Gene3DG3DSA:1.10.10.602.7E-13216261IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MVEHSLVVGT NNEDKDSDEQ KCSKIGEIEN STTPEIITNG ADGDPITPNS TTTSSPSFIR  60
RLFRVMSTPF RAGKREGVSH AKLKKSSSMW VSAIPFQALD VMLSEERHMW WMHSGYNQEV  120
KQSSDEDMDQ GSMDEMKESI SEDVEHKSVE RDTMDGAVQS KLCPRGRWRP AKDEKLRELV  180
SQYRPQNWSL IAEKLHGKSC RLRWFNQLDL WINRRPFTED GEERLLAAHR FQGNKWAMIV  240
RLFSGRTDNA VKNHWHVVMA QKFPELSRSS GRRKAQAPCR GK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-211652637108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S151_41V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-52myb domain protein 105